PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G13920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 307aa    MW: 32747.3 Da    PI: 5.9436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G13920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l++++++ G g W++ ++  g+ R++k+c++rw +yl
  ORUFI01G13920.1 14 RGRWTKEEDEKLARYIRENGEGAWRSMPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding51.32.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++E+++++++++ lG++ W++Ia +++ gRt++++k++w+++l
  ORUFI01G13920.1  67 RGNISPQEEDIILNLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.974961IPR017930Myb domain
SuperFamilySSF466891.71E-2711108IPR009057Homeodomain-like
SMARTSM007177.4E-121363IPR001005SANT/Myb domain
PfamPF002496.5E-151461IPR001005SANT/Myb domain
CDDcd001675.57E-101661No hitNo description
PROSITE profilePS5129422.9662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2465115IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001671.07E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRAPCCEKV GLRRGRWTKE EDEKLARYIR ENGEGAWRSM PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SPQEEDIILN LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRKGYEFL  120
RGGGGGAVVD VDLSKLPGGG KRRGGRTGRS SSGKEKTRTK EKDKAPAPEA AHNDDDGGGG  180
GGGIDNVSAA SHSHREEQAQ ASASGLTSDG LEEGPLGLSE EMVSGPVGPV SPKPERVAGG  240
GPGGAATEAV GQDMGDKSMD WDLVGLDDGF ANDDMWGSLS WDYGELVGPD GVHQGEVLSD  300
LFFLGNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24121155107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2886990.0AK288699.1 Oryza sativa Japonica Group cDNA, clone: J090061C22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628164.10.0PREDICTED: myb-related protein P
SwissprotP278983e-74MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0E0MV950.0A0A0E0MV95_ORYRU; Uncharacterized protein
STRINGLOC_Os01g19970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.14e-70myb domain protein 12